PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG093100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 667aa    MW: 71517.3 Da    PI: 5.7036
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG093100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.95.5e-161431557
                         HHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox 15 LeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         +e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Pavir.6KG093100.1.p  1 MEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 43
                         799*************************************995 PP

2START195.72.1e-611844021206
                          HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEE CS
                START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakae 80 
                          ela +a++el+++a +++p+W++ +   +++++e+ + f+ + +      + ea+r+ +vv+m+   lve+l+d+++    ++  + +a+
  Pavir.6KG093100.1.p 184 ELAVAAMDELLRMARLDAPLWSTGAagAQLDEEEYGRMFPGGLGprqygLRPEASRDGAVVIMTRDSLVEILMDVNRfaaVFSSIVSRAS 273
                          57899**********************9***********6655599999999************************88888888888*** PP

                          EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
                START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                          t+ev+s+g      galq+m++e+q++splvp R+++f+Ry++  ++g+w++vdvS+ds +++p    v +++++pSg+li++++ng+sk
  Pavir.6KG093100.1.p 274 THEVLSTGvagsynGALQVMSMEFQVPSPLVPtRESYFARYCKNNPDGTWAVVDVSLDSLRPNP----VLKCRRRPSGCLIQEMPNGYSK 359
                          ***************************************************************9....7********************* PP

                          EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          vtwvehv++++r++h+l+r+lv+sgla+gak+wv tl+rqce+
  Pavir.6KG093100.1.p 360 VTWVEHVEVDDRSVHNLYRPLVNSGLAFGAKRWVGTLDRQCER 402
                          *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000461.5E-13142IPR001356Homeobox domain
SMARTSM003894.5E-7148IPR001356Homeobox domain
PROSITE profilePS5007115.467144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-15151IPR009057Homeodomain-like
SuperFamilySSF466891.55E-13148IPR009057Homeodomain-like
CDDcd000866.69E-15145No hitNo description
PROSITE patternPS0002701942IPR017970Homeobox, conserved site
CDDcd146860.00684064No hitNo description
PROSITE profilePS5084838.84175405IPR002913START domain
SuperFamilySSF559614.23E-32176404No hitNo description
CDDcd088753.07E-118179401No hitNo description
SMARTSM002342.6E-56184402IPR002913START domain
PfamPF018522.1E-51185402IPR002913START domain
Gene3DG3DSA:3.30.530.201.7E-5277401IPR023393START-like domain
SuperFamilySSF559611.26E-24424656No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MEAFFKECPH PDDKQRKELS RELGLEPLQV KFWFQNKRTQ MKNQHERQEN AQLRAENDKL  60
RAENMRYKEA LSTASCPSCG GPAALGEMSF DEHHLRLENA RLRDEIDRIS GIAAKHVGKP  120
MVSFPVLSSP LAAAAARSPL DVVGAFGSAG LGPDPLFGVG TGAGELLRSV STGQLDADKP  180
MIVELAVAAM DELLRMARLD APLWSTGAAG AQLDEEEYGR MFPGGLGPRQ YGLRPEASRD  240
GAVVIMTRDS LVEILMDVNR FAAVFSSIVS RASTHEVLST GVAGSYNGAL QVMSMEFQVP  300
SPLVPTRESY FARYCKNNPD GTWAVVDVSL DSLRPNPVLK CRRRPSGCLI QEMPNGYSKV  360
TWVEHVEVDD RSVHNLYRPL VNSGLAFGAK RWVGTLDRQC ERLASAMASN IPNGDLGVIT  420
SIEGRKSMLK LAERMVASFC GGVTASAAHQ WTTLSGSGAE DVRVMTRKSV DDPGRPPGIV  480
LNAATSFWLP VPPKRVFDFL RDETSRSEWD ILSNGGAVQE MAHIANGRDH GNCVSLLRVN  540
SANSNQSNML ILQESCTDAS GSYVVYAPVD VVAMNVVLNG GDPDYVALLP SGFAILPDGP  600
PGAPNGEISA GLEAGGGSLL TVAFQILVDS VPTAKLSLGS VATVNSLIAC TVERIKAAVC  660
AEGNPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.94400.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509870.0AJ250987.1 Zea mays mRNA for OCL5 protein (ocl5 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972697.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLK3YGB70.0K3YGB7_SETIT; Uncharacterized protein
STRINGSi013285m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2